<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22365
| Description |
Uncharacterized protein |
| Sequence | MASQQQQPQPGGPMAQPGLQQSSTLQQLSQQQDFDPVHRFKMLIPQLKESLQNVMRIASLNLAQNTSIDNGTKSSDVSLQRFDKSLEEFYAICDQVELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYGQYLGMIKSQITCAKDIHNALLECSKKIAGKVPPQGII |
| Length | 175 |
| Position | Tail |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.415 |
| Instability index | 69.16 |
| Isoelectric point | 6.27 |
| Molecular weight | 19324.84 |
| Publications | PubMed=21551351
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP22365
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.67| 23| 25| 3| 27| 1
---------------------------------------------------------------------------
3- 27 (40.43/29.25) SQQQQPQPGG..PMAQPGLQQSstLQQ
29- 53 (38.24/21.61) SQQQDFDPVHrfKMLIPQLKES..LQN
---------------------------------------------------------------------------
|