<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22364
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTCVCQVPVAEGKSVQQTVDLLHKKLDQLGAVKQGSFCVDCETYHATANVGGQQSKLLYVMHNTETPLSCFALFEGGPCLKADTNFDILMVKLKSHFQNAKGYKVECRGSRYRYCDFLIKVGTVTMSSSARGISVEVEYCPCVVPGDCWNLMKEFMQSFLSSNVPELPSVFATKPEGLFAPADAIDTMTQYLEVFNKLRKLQIPGSNVR |
Length | 211 |
Position | Head |
Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.033 |
Instability index | 31.35 |
Isoelectric point | 7.48 |
Molecular weight | 23300.76 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22364
No repeats found
|