<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22359
Description |
Mediator complex subunit 28 |
Sequence | MASSMSGMFSGQQAPGAHPVGGPGGPGQPGFPVATPRPQGGNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQIECFFLQKRFQLSVQKPEQVVKEDVSELRYELQRKEMLVQKHLSKLHHWQQVLEEVSLQHRKPSDLPPPGPLTFLEQASANLPPAPLKPS |
Length | 180 |
Position | Head |
Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.472 |
Instability index | 55.00 |
Isoelectric point | 5.52 |
Molecular weight | 19829.26 |
Publications | PubMed=21551351
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22359
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.61| 15| 15| 105| 119| 1
---------------------------------------------------------------------------
105- 119 (24.28/15.21) QKPEQVVKEDVSELR
123- 137 (25.33/16.12) QRKEMLVQKHLSKLH
---------------------------------------------------------------------------
|