<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22353
Description |
Zgc:114119 |
Sequence | MAASLPQKPGMGGMPPQQQPHLPPGAAPGPGQQPMPPQGALREISPEFLCRIGQETVQDIVTRTMEIFQIARATQLPNGVTQSQAMYQDRFGKLQEHLRQLSLFFRKLRLLYERCVEMTADLQEGPAELVPFVGEELVSVRMESCSPAISQEKSEVLEKVRQKNQEMKVLMDQMRNLLWDINAMLTLRK |
Length | 189 |
Position | Head |
Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.415 |
Instability index | 61.85 |
Isoelectric point | 6.75 |
Molecular weight | 21354.64 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22353
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.48| 16| 17| 54| 69| 2
---------------------------------------------------------------------------
54- 69 (26.44/21.07) QET.VQDIVTRTMEIFQ
72- 88 (23.04/17.47) RATqLPNGVTQSQAMYQ
---------------------------------------------------------------------------
|