<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22353
| Description |
Zgc:114119 |
| Sequence | MAASLPQKPGMGGMPPQQQPHLPPGAAPGPGQQPMPPQGALREISPEFLCRIGQETVQDIVTRTMEIFQIARATQLPNGVTQSQAMYQDRFGKLQEHLRQLSLFFRKLRLLYERCVEMTADLQEGPAELVPFVGEELVSVRMESCSPAISQEKSEVLEKVRQKNQEMKVLMDQMRNLLWDINAMLTLRK |
| Length | 189 |
| Position | Head |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.415 |
| Instability index | 61.85 |
| Isoelectric point | 6.75 |
| Molecular weight | 21354.64 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22353
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.48| 16| 17| 54| 69| 2
---------------------------------------------------------------------------
54- 69 (26.44/21.07) QET.VQDIVTRTMEIFQ
72- 88 (23.04/17.47) RATqLPNGVTQSQAMYQ
---------------------------------------------------------------------------
|