<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22352
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPSKPPPPLPQSQVPLAAQMPPQLGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQGTEYRTIIVCLSVFQNRHSPDHPGLTGSQPNSSSLR |
| Length | 227 |
| Position | Head |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.637 |
| Instability index | 57.86 |
| Isoelectric point | 9.19 |
| Molecular weight | 24864.15 |
| Publications | PubMed=21551351
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22352
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.41| 24| 24| 23| 46| 1
---------------------------------------------------------------------------
36- 62 (30.40/ 9.86) QSQVPLAA.QMP...pqLGdEGPALRKPGAM
140- 161 (34.22/11.96) NSFSPLTG.A.......LL.TGFRLHTGPLP
162- 190 (26.79/ 7.88) .EQYRLMHiQPPkkkskHK.HKHHRPQDPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.14| 16| 102| 111| 129| 2
---------------------------------------------------------------------------
111- 129 (27.61/23.10) PELPGMidcPGTQ.DGSSLR
211- 227 (27.52/14.00) PDHPGL...TGSQpNSSSLR
---------------------------------------------------------------------------
|