Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPSKPPPPLPQSQVPLAAQMPPQLGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQGTEYRTIIVCLSVFQNRHSPDHPGLTGSQPNSSSLR |
Length | 227 |
Position | Head |
Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.637 |
Instability index | 57.86 |
Isoelectric point | 9.19 |
Molecular weight | 24864.15 |
Publications | PubMed=21551351 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22352 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 91.41| 24| 24| 23| 46| 1 --------------------------------------------------------------------------- 36- 62 (30.40/ 9.86) QSQVPLAA.QMP...pqLGdEGPALRKPGAM 140- 161 (34.22/11.96) NSFSPLTG.A.......LL.TGFRLHTGPLP 162- 190 (26.79/ 7.88) .EQYRLMHiQPPkkkskHK.HKHHRPQDPLP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.14| 16| 102| 111| 129| 2 --------------------------------------------------------------------------- 111- 129 (27.61/23.10) PELPGMidcPGTQ.DGSSLR 211- 227 (27.52/14.00) PDHPGL...TGSQpNSSSLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FYLLREL 2) KHKHK 3) YRLMHIQ | 66 177 164 | 72 181 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab