<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22345

Description Uncharacterized protein
SequenceMKVVNLKQAILQAWKERWSDYQWAINIKKNYPKGATWDYLNLAEALMEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAVSKFEDFSRELCVKSLLEIMDMFCHRLSCHGKAEECIGLCRALLGVVVWLLQGCAWYCERLRELGPSPSTEASLRACQERLHSLMNSTKNRALVHIARLEEQGSWSNVEQAVLKVTDALSSVPNQTLRTKLEESLSLVKSIPLMLSVQSDPPHRASFPSIHAFIMLEGTMNLTGETQPLVEQLMMIKRMQRIPAPLFVLEIWKACFTGLIESPEGTEELKWTAFTFLKIPQVLLRLKKYPQGDKGQDFMEDVNIAFQYLLKLTPLLDKADQRCNCDCLGMLLQECNKLGLLSDINTTTLTSKREFAPRLKTAENANIQPNPGLILRAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFIKLNEFPKHISGEGSKSASVRALLFDISFLMLCHVVQTYGSEVILSDPSPSGETPFFETWLQTCMPEEGKTLNPDHPCFRPEPGKVESLVTLLNNSPEMKLVQVKWHEICLSTPAAILEVLNAWENGVLSVEAVQKITDNIKGKVCSMAICAVAWLVAHVRMLGRDEREKPQTMIRQLVTPLYGENTLQFYNERVIIMSSIMEHMCADVFQQTAATLRPPVEGQEPIPYRNLLPAKEPIHTALSMQFQAVLRKGWVDSRALHLFESLLNMGGVFWFTNNLVKELLKETRQEWANRVVELLYSIFCLDTQQITLTLLGTILPNLLTDSAHWHSLADPPGKALAKLSVWCALSSYSSHHKGSFSARQRKRQREDIEDYNSLFPLDDTQPSKLMRLLSSNEDEPVALSSPGDRSMSSSLSASQLHTVNMRDPLNRVLANLFLLISSILGSKMAGPHTQFVQSFMEECVECLEQGSRGSILQFMPFTMVSELVKLPALAKPKVVLAITDLTLPLGRRVAAKAISAL
Length985
PositionTail
OrganismStegastes partitus (bicolor damselfish)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Pomacentridae> Stegastes.
Aromaticity0.07
Grand average of hydropathy-0.040
Instability index46.08
Isoelectric point7.26
Molecular weight110161.04
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
enteric nervous system development	GO:0048484	IEA:Ensembl
interstitial cell of Cajal differentiation	GO:0061453	IEA:Ensembl
retinal cone cell development	GO:0046549	IEA:Ensembl
thymus development	GO:0048538	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.64|      13|      15|     705|     719|       1
---------------------------------------------------------------------------
  705-  718 (20.39/19.38)	ALSMqFQAVLRKG...W
  723-  738 (20.24/ 7.52)	ALHL.FESLLNMGgvfW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     163.14|      38|     172|     200|     241|       2
---------------------------------------------------------------------------
  200-  237 (61.10/34.19)	LSSVPNQTLRTKLEESLSLVKSIPLMLSVQSDPP..HRAS
  372-  409 (49.76/25.64)	LSDINTTTLTSKREFAPRL.KTAE.NANIQPNPGliLRAE
  422-  458 (52.28/27.00)	DHSKSPEGLLGVLGHMLS.GKSLDLLLAAAAATG..KLKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.81|      24|     388|      89|     112|       8
---------------------------------------------------------------------------
   89-  112 (44.65/24.39)	SRELCVKSLLEIM.......D..MFCHRLSCHG
  117-  146 (33.04/16.41)	CIGLC.RALLGVVvwllqgcA..WYCERLRELG
  478-  503 (33.12/16.47)	SKSASVRALLFDI.......SflMLCHVVQTYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.98|      17|      20|     857|     875|      10
---------------------------------------------------------------------------
  857-  873 (28.67/22.21)	LSSNEDEPVALSSPGDR
  879-  895 (29.31/14.75)	LSASQLHTVNMRDPLNR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22345 with Med24 domain of Kingdom Metazoa
Unable to open file!