<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22344
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MSGGPAVRVSIESSCEKQVQEVALDGTETYVPPLSMSQNLSKLAQRIDFSQGSDSEEEGVEGEPRDREWGKQEQEEEEGTVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSVVKEKKYMALDPVSQDPTTPQVFQLISKKKSLGTAAQLLMKGAEKLSKSVAENQENRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDIDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFRRPQKNKSSTQPWHVKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLCHSTGEKKNNRASPEKSKPDNHLYVLEHNLHQMMREFHKQQLSSVVMPHPASAPFGHKRLRLAGPLAYDKTEISNLQQSEGLLEKIIKQAKHIFLRSRSIQLQLNIGVEQIRVVHRDGRVITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVMGWHVLSFSNHVGLGPVESIGNASAVTVASPNGEYAISVRNGPESGCKVLVQFPRSQTKELPKSDIIQDAKWSHLRGPYKEVHWSKMEGRNFVYKMELLMAALTPCP |
| Length | 594 |
| Position | Head |
| Organism | Stegastes partitus (bicolor damselfish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Pomacentridae> Stegastes.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.512 |
| Instability index | 56.26 |
| Isoelectric point | 8.59 |
| Molecular weight | 66920.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22344
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 181.63| 57| 67| 300| 359| 1
---------------------------------------------------------------------------
300- 359 (95.18/65.94) QLSREavqIKSQIPHIVVKNQIISQPFPG..LQLSISLCHSTGEKKNNRASP...EK.SKPDNHLY
367- 429 (86.45/52.89) QMMRE...FHKQQLSSVVMPHPASAPFGHkrLRLAGPLAYDKTEISNLQQSEgllEKiIKQAKHIF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.25| 16| 18| 54| 69| 5
---------------------------------------------------------------------------
54- 69 (30.72/19.13) DSEEEG.VEGEPRDREW
74- 90 (28.53/17.26) QEEEEGtVKFQPSLWPW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.30| 30| 307| 202| 239| 7
---------------------------------------------------------------------------
202- 239 (50.00/59.44) SAGSLFPHHGTFEV.IKNTdidldkkiPEDYCPLDVQIP
511- 541 (49.31/38.67) SAVTVASPNGEYAIsVRNG........PESGCKVLVQFP
---------------------------------------------------------------------------
|