<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22333
Description |
Uncharacterized protein |
Sequence | LCEPWVLLAYVCEWEKRPKSTHCPSIPLVCSWSCRNLVAFTTDLKNDDDDKGKHTHTHTHT |
Length | 61 |
Position | Tail |
Organism | Seriola lalandi dorsalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Carangiformes> Carangidae> Seriola.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.580 |
Instability index | 19.87 |
Isoelectric point | 6.54 |
Molecular weight | 7064.95 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22333
No repeats found
No repeats found
|