<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22332
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MSGGPAVRVSIESSCEKQVQEVALDGTETYVPPLSMSQNLAKLAQRIDFSQGSDSEEDGVEGEPRDREWGKQEPEEEEGTVKFQPSLWPWDSVRNNLRSALTEMCVLHDVLSVVKEKKYMALDPVSQDPTTPQVFQLISKKKSLATAAQLLLKGAEKLTKSVAENQENRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDIDLDKKLPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFRRPPKTKAGTQAWHVKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLCHSTGEKKNHRASPEKPKPDDHLYVLEHNLHQMMREFHKQQLSSVVMPHPASAPFGHKRLRLAGPLAYDKTEISSLQQSEGLLEKIIKQAKHIFLRSRSIQLQLNIGVEQIRVVHRDGRVITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVMGWHVLSFSNHVGLGPVESIGNASAVTVASPNGEYAISVRNGPESGCKVLVQFPRSLTKELPKSDVIQDTKWSHLRGPNKEVHWSKMEGRNFVYKMELLMAALTPCP |
Length | 594 |
Position | Head |
Organism | Seriola lalandi dorsalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Carangiformes> Carangidae> Seriola.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.475 |
Instability index | 54.85 |
Isoelectric point | 8.46 |
Molecular weight | 66686.48 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22332
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 117.87| 37| 67| 316| 381| 3
---------------------------------------------------------------------------
323- 359 (68.72/72.44) SQPFPG..LQLSISLCHSTGEKKNHRASP...EK.PKPDDHLY
387- 429 (49.15/12.62) SAPFGHkrLRLAGPLAYDKTEISSLQQSEgllEKiIKQAKHIF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.89| 15| 303| 228| 242| 5
---------------------------------------------------------------------------
228- 242 (30.17/20.73) PEDYCPLDVQIPSDL
530- 544 (28.72/19.37) PESGCKVLVQFPRSL
---------------------------------------------------------------------------
|