<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22331

Description Uncharacterized protein
SequenceMRLHSMTSSLSASSRETAKMADVVNVGVNLDAFSHAISGIQALRSSVSRVFESLKDGMKNRETLEGREKQFIAEFQDNLQAVNRDLNELERLSGLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGASAKRRPKVQPSTLVLPPQYVDDVISRIGRMFPDMTIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTVVRGFNENVYNEDRKLDIWTKSQYQVFQKTWLRSYIKLFQSSCQRCGRFLQDGLPPTWRDFRTLEAFHDTCRM
Length304
PositionTail
OrganismSeriola lalandi dorsalis
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Carangaria> Carangiformes> Carangidae> Seriola.
Aromaticity0.08
Grand average of hydropathy-0.378
Instability index42.45
Isoelectric point9.75
Molecular weight34569.22
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22331
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.57|      24|     205|      46|      90|       2
---------------------------------------------------------------------------
   15-   41 (33.66/43.34)	RETAKMADVVNvgvNLDAFSHAISGIQ
   67-   90 (38.91/13.82)	REKQFIAEFQD...NLQAVNRDLNELE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.13|      23|     225|      43|      65|       3
---------------------------------------------------------------------------
   43-   65 (38.91/20.01)	LRSSVSRVFESLKDGM....KNRETLE
  270-  296 (38.22/19.56)	FQSSCQRCGRFLQDGLpptwRDFRTLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.97|      32|      32|     166|     197|       4
---------------------------------------------------------------------------
  166-  197 (56.67/40.37)	RPKVQPSTLVLPPQYVDDVISRIGRMFPDMTI
  201-  232 (50.30/35.10)	RPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22331 with Med27 domain of Kingdom Metazoa

Unable to open file!