<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22330
Description |
Uncharacterized protein |
Sequence | MFPDMTIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTVVRGFNENVYNEDRKLDIWTKSQYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQSSCQRCGRFLQDGLPPTWRDFRTLEAFHDTCRM |
Length | 140 |
Position | Tail |
Organism | Seriola lalandi dorsalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Carangiformes> Carangidae> Seriola.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.129 |
Instability index | 34.13 |
Isoelectric point | 9.37 |
Molecular weight | 16484.03 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22330
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.74| 14| 25| 97| 111| 1
---------------------------------------------------------------------------
97- 111 (23.87/20.10) TWlRSYIKL..FQSSCQ
124- 139 (24.87/15.75) TW.RDFRTLeaFHDTCR
---------------------------------------------------------------------------
|