<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22326
Description |
Uncharacterized protein |
Sequence | MASQQQQPGGPMSQPGLQQPTSIQQQQQQLSQQQDFDPVHRFKMLIPQLKESLQNVMKIASLNLAHNTAIDNGIKSSDASVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLGMIKSQISCAKDIHNALLECSKKIAGKGQPQGLM |
Length | 177 |
Position | Tail |
Organism | Seriola dumerili (Greater amberjack) (Caranx dumerili) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Carangiformes> Carangidae> Seriola.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.488 |
Instability index | 71.18 |
Isoelectric point | 6.40 |
Molecular weight | 19594.12 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP22326
No repeats found
|