<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22319

Description Uncharacterized protein
SequenceMKVVNLKQAILQAWKERWSDYQWAINIKKNFPKGATWDYLNLAEALMEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFEDFSRELCVQSLLEIMDMFCHRLSCHGKAEECIGLCRALLGVVVWLMQGCAWYCERLRELGPSASTEASLRACQERLHNLMTSTKNRALVHIARLEEQGSWSSVEQAMLKVTDGLSSVPNQTLRTNLEESLSLVKGIPVMLSVQCDPPLHASFPSIHAFIMLEGTMNLTGETQPLVEQLMMIKRMQQIPAPLFVLEIWKACFTGLIESPEGTEELKWTAFTFLKIPQVLLRLKKYPQSDKGQDFMEDVNIAFQYLLKLTPLLDKADQRCNCDCLGMLLQECNKLGLLSDSNTTCLTSKREFAPRLKTAENANIQPNPGLILRAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFIKLNEFPKHISGEGSKSASVRALLFDISFLMLCHVVQTYGSEVILSDPSPSGETPFFETWLQTCMPEEGKTLNPDHPCFRPEPGKVESLVTLLNNSSEMKLVQVKWHEICLSTPAAILEVLNAWENGVLSVEAVQKITDNIKGKVCSMAICAVAWLVAHVRMLGRDEREKPQTMIRQLVTPLYGENTLQFYNERVIIMSSIMEHMCADVFQQTAATLRPPVEGQEPIPYRNLLPAKEPIHKALSKQFQAVLRKGWVDSRALHLFESLLNMGGVFWFTNNLVKELLKETRQEWANRVVELLYSIFCLDTQQITLTLLGTILPNLLTDSAHWHSLADPPGKALAKLSVWCALSSYSSHHKGSFSARQRKRQREDIEDYNSLFPLDDTQPSKLMRLLSSNEDEPVALSSPGDRSMSSSLSASQLHTVNMRDPLNRVLANLFLLISSIVGSKMAGPHTQFVQSFMEECVECLEQGSRGSILQFMPFTMVSELVKLPALAKPKVVLAITDLTLPLGRRVAAKAISAL
Length985
PositionTail
OrganismSeriola dumerili (Greater amberjack) (Caranx dumerili)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Carangaria> Carangiformes> Carangidae> Seriola.
Aromaticity0.07
Grand average of hydropathy-0.032
Instability index46.53
Isoelectric point6.89
Molecular weight110048.88
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
enteric nervous system development	GO:0048484	IEA:Ensembl
interstitial cell of Cajal differentiation	GO:0061453	IEA:Ensembl
retinal cone cell development	GO:0046549	IEA:Ensembl
thymus development	GO:0048538	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22319
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     139.81|      42|     113|     289|     330|       1
---------------------------------------------------------------------------
  289-  330 (74.47/44.62)	GLI..ESPEGTEELKWTAFTFLKIPQVLLRLKKYPQSDKGQDFM
  403-  446 (65.35/38.32)	GLIlrAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      66.70|      15|      17|     139|     153|       2
---------------------------------------------------------------------------
  139-  153 (27.15/17.02)	C.ERLRELGPSASTEA
  158-  173 (21.42/11.77)	CqERLHNLMTSTKNRA
  177-  190 (18.13/ 8.76)	I.ARLEEQGSWSSVE.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.49|      25|     115|     682|     716|       6
---------------------------------------------------------------------------
  683-  707 (45.09/24.28)	PVEGQEPIPYRNLLPAKEPIHKALS
  844-  868 (41.39/23.95)	PLDDTQPSKLMRLLSSNEDEPVALS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.86|      16|      91|     792|     807|       9
---------------------------------------------------------------------------
  792-  807 (30.37/21.13)	HWHSLADPPGKALAKL
  885-  900 (28.49/19.31)	HTVNMRDPLNRVLANL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.87|      12|      25|     342|     354|      11
---------------------------------------------------------------------------
  342-  354 (16.70/13.66)	KLTpLLDKADQRC
  368-  379 (21.17/11.45)	KLG.LLSDSNTTC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.85|      24|     388|      89|     112|      12
---------------------------------------------------------------------------
   89-  112 (45.24/31.01)	SRELCVQSLLEIMD..MFCHRLSCHG
  478-  503 (34.61/21.90)	SKSASVRALLFDISflMLCHVVQTYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.40|      20|     675|     263|     282|      13
---------------------------------------------------------------------------
  263-  282 (36.90/27.73)	QLM...MIKRMQQIPA...PLFVLEI
  941-  966 (24.50/15.65)	QFMpftMVSELVKLPAlakPKVVLAI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22319 with Med24 domain of Kingdom Metazoa
Unable to open file!