<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22311

Description Uncharacterized protein
SequenceMASQPPPQAVSTNPAAHQAAVLQPQQPPLGPQQQQQQQQQQDFDPVHRFKMLIPQLKESLQSVMSVASQNFAHNTSIDNGVNARMYIDGADLTAANVTNQQCIKSNDGTVQRFDKSLEEFYALCDQLELCLRLAHECLSQSIDSAKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKTQQAIL
Length205
PositionTail
OrganismPygocentrus nattereri (Red-bellied piranha)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes> Characoidei> Pygocentrus.
Aromaticity0.04
Grand average of hydropathy-0.473
Instability index63.91
Isoelectric point6.03
Molecular weight22560.20
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
eye photoreceptor cell development	GO:0042462	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22311
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.63|      29|      68|      41|      69|       1
---------------------------------------------------------------------------
   41-   69 (50.74/30.01)	QDFD.PVHRFKMLIPQLKESLQSVMSVASQ
  111-  140 (47.89/28.01)	QRFDkSLEEFYALCDQLELCLRLAHECLSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.91|      10|      20|       4|      18|       2
---------------------------------------------------------------------------
    4-   18 (14.87/15.42)	QPPpqavsTNPAAHQ
   26-   35 (21.05/ 8.94)	QPP.....LGPQQQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22311 with Med29 domain of Kingdom Metazoa
Unable to open file!