<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22308
| Description |
Uncharacterized protein |
| Sequence | MASQPPPQAVSTNPAAHQAAVLQPQQPPLGPQQQQQQQQQQDFDPVHRFKMLIPQLKESLQSVMSVASQNFAHNTSIDNGVKSNDGTVQRFDKSLEEFYALCDQLELCLRLAHECLSQSIDSAKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKTQQAIL |
| Length | 183 |
| Position | Tail |
| Organism | Pygocentrus nattereri (Red-bellied piranha) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Pygocentrus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.510 |
| Instability index | 71.39 |
| Isoelectric point | 6.28 |
| Molecular weight | 20195.58 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22308
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.91| 10| 20| 4| 18| 1
---------------------------------------------------------------------------
4- 18 (14.87/15.05) QPPpqavsTNPAAHQ
26- 35 (21.05/ 8.72) QPP.....LGPQQQQ
---------------------------------------------------------------------------
|