<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22306

Description Uncharacterized protein
SequenceMPLRIDVTCAPALTVGEIMADVMNVGVNLEAFSQAINAIQALRSSVTRVFDSLKDGMKNKETLEGREKAFIAEFQDNLQSVNRDLTELERLSNLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQIGASAKRRPKVQPSTLVLPIQYVDDVISRIGRMFPDMSIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTIVRGYHENVHSEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQTPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ
Length329
PositionTail
OrganismPygocentrus nattereri (Red-bellied piranha)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes> Characoidei> Pygocentrus.
Aromaticity0.08
Grand average of hydropathy-0.234
Instability index45.54
Isoelectric point9.21
Molecular weight37243.46
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
retinal cone cell development	GO:0046549	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22306
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.87|      32|      32|     165|     196|       1
---------------------------------------------------------------------------
  165-  196 (55.55/41.87)	RPKVQPSTLVLPIQYVDDVISRIGRMFPDMSI
  200-  231 (50.32/37.27)	RPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.52|      14|      30|      92|     112|       2
---------------------------------------------------------------------------
   92-  105 (25.28/ 8.71)	SNLVGRPSESHPLH
  123-  136 (23.23/15.90)	SQLLQAYKWSNKLQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22306 with Med27 domain of Kingdom Metazoa

Unable to open file!