<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22293

Description Uncharacterized protein
SequenceMKVVNLKQAILQAWKERWSDYQWAVNIKKNFPKGATWDYLNFAEALMEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDGFSRELCVKSLLEIMDMFCHRLNCHGKAEECIGLCRALLGVVVWLLQGCAFYCDQLRELGPSASTEAILRACQERLHGLMNSTKNKALVHILKQESLSNLMNSPSLSLFSLSLSLSLSLSLSLSLFLFSIPLMLSVQSEPPAHASFPSVHAFIMLEGTMNLTGETQPLVEQLMMIKRMQRIPGPLFVLEIWKACFTGLIESPEGTEELKWTAFTFLKIPQVLLRLKKYPQGDKGQDFTEDVNIAFQYLLKLTPLLDKADQRCNCDCLGMLLQECNKLGLLSDSNTEGLTSKRNEDREFAPRLKTAENANIQPNPGLILRAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFSASVRAQLFDISFLMLCHVVQTYGSEVILSDPSPSVETPFFETWLQTCMPEEGKTLNPDHPCFRPEPGKVESLVTLLNNSSEMKLVQVKWHEICLSTPAAILEVLNAWENGVLSVEAVQKITDNIKGKVCSMAICAVAWLVAHVRMLGRDEREKPQTMIRQLVTPLYAENTMQFYNERVVIMSSIMEHMCADVFQQTGAMLRSPIEGQEPIAYRNLLPPKEPIHQSLSKQFQVVLRKGWVDSRALHLFESLLNMGGVFWFTNNLIKELLKETRQEWASRVVELLYSIFCLDMQQITLTLLGTILPNLLTDSAHWHSLADPPGKALAKLSVWCALSSYSSHHKGPFSARQRKRQREDIEDYNSLFPLDDTQPSKLMRLLSSNEDEPVALSSPGDRSMSSSLSPSQLHTVNMRDPLNRVLANLFLLFSSILGSKMAGPHTQFVQSFLEECVECLEQGSRGSILQFMPFTMVSELVKLPALAKPKVVLAITDLNLPLGRRVAAKAISAL
Length963
PositionTail
OrganismPoecilia mexicana
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae> Poecilia.
Aromaticity0.07
Grand average of hydropathy0.014
Instability index49.35
Isoelectric point6.62
Molecular weight107567.11
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22293
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.01|      16|      16|     189|     204|       1
---------------------------------------------------------------------------
  182-  201 (22.48/ 9.87)	SLSnlmnSPSLSLFSLSLSL
  202-  218 (23.53/10.70)	SLS...lSLSLSLFLFSIPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.48|      20|      30|     454|     474|       3
---------------------------------------------------------------------------
  454-  474 (30.41/22.91)	LKSFSASVRAQLFDiSFLMLC
  486-  505 (39.08/25.11)	LSDPSPSVETPFFE.TWLQTC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.35|      31|      90|     770|     801|       4
---------------------------------------------------------------------------
  770-  801 (55.94/42.50)	HWHSLADPPGKALAKLSVWCAlSSYSSHHKGP
  863-  893 (54.41/36.40)	HTVNMRDPLNRVLANLFLLFS.SILGSKMAGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.59|      14|      16|     267|     282|       5
---------------------------------------------------------------------------
  277-  293 (16.40/15.88)	WKAcFT.glIESPEGTEE
  296-  312 (20.19/ 6.89)	WTA.FTflkIPQVLLRLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.90|      17|      17|     233|     249|       6
---------------------------------------------------------------------------
  233-  249 (29.70/23.50)	PSVHAFIMLEGTMNLTG
  253-  269 (30.20/24.04)	PLVEQLMMIKRMQRIPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.89|      10|      17|     117|     126|       8
---------------------------------------------------------------------------
  117-  126 (20.12/12.70)	CIGLCRAL..LG
  135-  146 (16.77/ 9.29)	CAFYCDQLreLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.88|      20|      88|     511|     542|       9
---------------------------------------------------------------------------
  511-  530 (35.99/33.53)	KTLNPDHPCFRPEPGKVESL
  543-  562 (32.89/10.35)	VQVKWHEICLSTPAAILEVL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22293 with Med24 domain of Kingdom Metazoa

Unable to open file!