<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22288
Description |
Uncharacterized protein |
Sequence | MSEPISVGVNLDAFSHAISGIQALRSSVSRVFESLKDGMKNRETLEGREKRFISEFQDTLQAVNRDLNELERLSGLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGASAKRRPKVQPSTLVLPPQYVDDVISRVGRMFPDMTIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTVVRGFNENVYSEDGKLDIWTKSQYLVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQSSCQRCGRFLQDGLPPTWRDFRTLEAFHDTCRL |
Length | 311 |
Position | Tail |
Organism | Poecilia mexicana |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Poecilia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.284 |
Instability index | 47.50 |
Isoelectric point | 9.51 |
Molecular weight | 35332.17 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | retinal cone cell development GO:0046549 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP22288
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 62.57| 12| 247| 48| 59| 4
---------------------------------------------------------------------------
48- 59 (22.06/14.77) REKRFISEFQDT
283- 291 (18.57/11.36) RCGRFL...QDG
297- 308 (21.93/14.65) RDFRTLEAFHDT
---------------------------------------------------------------------------
|