<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22264
| Description |
Uncharacterized protein |
| Sequence | MTPELFCQHRKRSKMASQQQQQQQAGGPMSQPGLQQPASIQQQQQQQLSQQQDFDPVHRFKMLIPQLKESLQNLMKIASMNLSYNTSIDNGIKSSDTSVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLTMIKSQISCAKDIHNALLECSKKIAGKGPPQGMM |
| Length | 195 |
| Position | Tail |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.625 |
| Instability index | 73.74 |
| Isoelectric point | 8.19 |
| Molecular weight | 21944.84 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22264
No repeats found
|