<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22262
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MEVPGSDSDWRSTQFRQKVVAQIDEAMRKAGPGTTTHKSGTDMENQVYNKAKTRDEYLSLVARLIIHFRDIRKKEALSGSPEHPMNALTNLTGVGVGPGAIGMGPRPAGAQVGGMGPMGQMQIGQHVMGGVPGNPQGKLSQRSSSAAQHSRGLSRPEPALERRRRAVRCQQLPAERAPQHDVQTAAAARQTLCDGAAQHLGPERPAGVPVCRLKPLSASEQILQIFSPRFL |
| Length | 231 |
| Position | Tail |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.570 |
| Instability index | 44.75 |
| Isoelectric point | 10.22 |
| Molecular weight | 24834.04 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22262
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 141.44| 44| 96| 81| 125| 1
---------------------------------------------------------------------------
81- 125 (80.02/42.90) PEHPMNALTNLTGvGVGPGAIGMG.P.RPAGAQVGGMGPMGQM.QIGQ
132- 159 (32.23/11.89) PGNPQGKLSQRSS.SAAQHSRGLSrP.EPA..................
197- 224 (29.19/ 9.90) ...................AQHLG.PeRPAGVPVCRLKPLSASeQILQ
---------------------------------------------------------------------------
|