<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22260
Description |
Uncharacterized protein |
Sequence | LVVDMEPPSKPGSNQVADVVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCAPESYVQCHAPTSSAYEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDDFKKMREQIGQTHKVCVLLCNSPPYLLPAVESVSYTGCTAESLRGIHFSVVAPRKLPALRSLFERASPLNGAVEPLPDYSQDPFHMVLIRGISLPGEKPHRGRRLCTSLTRQSFCNAPSYKVMRLQAFIRVTSFFIL |
Length | 264 |
Position | Unknown |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.030 |
Instability index | 48.38 |
Isoelectric point | 5.76 |
Molecular weight | 28944.83 |
Publications | PubMed=17554307
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22260
No repeats found
No repeats found
|