<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22257
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | IAGVAKSEVQARHRFQAELEFVQCLANPYYLNFLAQRGFLKERPFINYLKYLLYWKEPEYSKFLKYPHCLHMLELLQYEHFRKEQVNAQCAKFIDEQQLLHWQHYSRKRTRLQQALAEQQQAQQPPQPHGNAAAK |
Length | 135 |
Position | Middle |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.719 |
Instability index | 41.73 |
Isoelectric point | 9.28 |
Molecular weight | 16248.44 |
Publications | PubMed=17554307
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 109.30| 21| 21| 60| 80| 1
---------------------------------------------------------------------------
19- 41 (22.05/ 9.86) .LEFVQCLanpYYLN...FLAQ...RGFLK
45- 62 (19.74/ 8.17) FINY.........LK...YLLYwkePEYSK
63- 83 (38.45/21.85) FLKYPHCL...HMLE...LLQY...EHFRK
84- 107 (29.06/14.98) EQVNAQCA...KFIDeqqLLHW...QHYSR
---------------------------------------------------------------------------
|