<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22252
| Description |
Cyclin C |
| Sequence | MAGNFWQSSHYLQWVLDKQDLIKERQKDLKFLSEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMDKILEIIRVILKLYDQWKNFDDRKEIAAVLNKMPKPKPPPTSDGDQNSNGNQGNSYSQS |
| Length | 283 |
| Position | Kinase |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.155 |
| Instability index | 46.45 |
| Isoelectric point | 6.94 |
| Molecular weight | 33140.11 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | cell division GO:0051301 IEA:UniProtKB-KW
glomerular visceral epithelial cell development GO:0072015 IEA:Ensembl
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP22252
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.96| 11| 23| 5| 17| 1
---------------------------------------------------------------------------
5- 17 (19.07/20.36) FWQSSHYlqWVLD
31- 41 (20.89/13.97) FLSEEEY..WKLQ
---------------------------------------------------------------------------
|