<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22244
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MEVPGSDSDWRSTQFRQKVVAQIDEAMRKAGPGTTTHKSGTDMENQVYNKAKTRDEYLSLVARLIIHFRDIRKKEALSGSPEHPMNALTNLTGVGVGPGAIGMGPRPAGAQVGGMGPMGQMQIGQHVMGGVPGNPQGSECFLCVMFQQWQRSPRRRRRGGKPRLVVMRLCVLRCQQLPAERAPQHDVQTAAAARQTLCDGAAQHLGPERPAGVPVCRLKPRPPGVVRSCHCLNAFWVTETQQTSFFLVGRSCLCL |
Length | 255 |
Position | Tail |
Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.398 |
Instability index | 47.76 |
Isoelectric point | 9.91 |
Molecular weight | 27846.92 |
Publications | PubMed=17554307
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22244
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.31| 15| 25| 97| 120| 1
---------------------------------------------------------------------------
84- 102 (19.89/ 8.88) PMNALTNLTGVG.vgpgAIG
105- 124 (23.43/19.69) PRPAGAQVGGMGpmgqmQIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.27| 23| 25| 133| 157| 2
---------------------------------------------------------------------------
133- 155 (47.79/27.07) GNPQGSECFLCVM.FQQW..QRSPRR
160- 185 (34.48/13.08) GKPRLVVMRLCVLrCQQLpaERAPQH
---------------------------------------------------------------------------
|