<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22243
| Description |
Uncharacterized protein |
| Sequence | LVVDMEPPSKPGSNQVADVVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGQMLMAGGQRGPVPQTGMQQVSSAMEDDLLMDLI |
| Length | 92 |
| Position | Unknown |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.074 |
| Instability index | 45.09 |
| Isoelectric point | 4.05 |
| Molecular weight | 9903.17 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22243
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.28| 10| 16| 51| 60| 1
---------------------------------------------------------------------------
51- 60 (19.94/10.73) GPPAETDFGQ
69- 78 (20.34/11.08) GPVPQTGMQQ
---------------------------------------------------------------------------
|