<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22240
| Description |
Mediator complex subunit 30 |
| Sequence | MTTPPLAPPFGGQQAQAGRDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPNTHQDRLGKLQEHLRMLSVLFRKLRLVYDKCNENCAGLELVPPEQLIPFVEDEGSKRESRSGGQSRPASEERREIVEVNKKLKQKNQQLKQIMDQLRNLIWEINSMLAVRS |
| Length | 172 |
| Position | Head |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.605 |
| Instability index | 60.66 |
| Isoelectric point | 9.12 |
| Molecular weight | 19715.48 |
| Publications | PubMed=17554307
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP22240
No repeats found
|