<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22233
| Description |
Mediator complex subunit 17 |
| Sequence | MSGGPAVRISIESSCEKQVQEVALDGTETYVPPLSMSQNLAKLAQRIDFSQGSDSEEDAVEGESRDREWSKQEPEEEEGAVKFQPSLWPWDSVRNNLRSALTEMCVLHDVLSVVKEKKYMALDPVSHDPSATPQMFQLISKKKSLATAAQILLKGAERLSKSVAENQENRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDIDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFRRPQKNKAGTFCHRTTRTSRI |
| Length | 290 |
| Position | Head |
| Organism | Oryzias melastigma (Marine medaka) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.641 |
| Instability index | 56.01 |
| Isoelectric point | 6.27 |
| Molecular weight | 32615.45 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22233
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.42| 16| 18| 54| 69| 1
---------------------------------------------------------------------------
54- 69 (28.21/18.07) DSEEDAVEGESRDREW
75- 90 (31.20/20.69) EEEEGAVKFQPSLWPW
---------------------------------------------------------------------------
|