<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22230
| Description |
Uncharacterized protein |
| Sequence | MVLCACATQRDSTQIKMASSISGMFPGQQPPGSHPVGGPGAPGQPGFPMGAPRAQGNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKELLVQKHLAKLHHWQQVLEDVSGQHRKPTDLPPPGPLAFLEQASANLPPAPLKPN |
| Length | 196 |
| Position | Head |
| Organism | Oryzias melastigma (Marine medaka) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.474 |
| Instability index | 48.97 |
| Isoelectric point | 5.73 |
| Molecular weight | 21458.14 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22230
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.54| 15| 15| 121| 135| 1
---------------------------------------------------------------------------
121- 135 (23.72/16.52) QKPEQVVKEDVSELR
139- 153 (23.82/16.61) QRKELLVQKHLAKLH
---------------------------------------------------------------------------
|