<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22226
| Description |
Uncharacterized protein |
| Sequence | MASQQQQQQQAGGPMSQPGLQQPASIQQQQQLSQQQDIDPVHKFRMLIPQLKESLQNLMKIASMNLSYNTSIDNGIKSSDTSVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLTMIKSQISCAKDIHNALLECSKKIAGKGQPQGIM |
| Length | 179 |
| Position | Tail |
| Organism | Oryzias melastigma (Marine medaka) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Beloniformes> Adrianichthyidae> Oryziinae>
Oryzias.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.522 |
| Instability index | 70.56 |
| Isoelectric point | 6.27 |
| Molecular weight | 19924.48 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP22226
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.71| 19| 33| 20| 39| 2
---------------------------------------------------------------------------
20- 39 (28.51/15.30) LQQPASIqQQQQLSQQQDID
55- 73 (32.20/13.77) LQNLMKI.ASMNLSYNTSID
---------------------------------------------------------------------------
|