<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22222
| Description |
Uncharacterized protein |
| Sequence | SVPGSAPKIGANQVSDVVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCAPESYVQCHAPTSSAYEFVSWIDKIQFMGGGAESCSLIAEGLSVALQLFDDFKKMREQIGQTHKVCVLLCNSPPYLLPAPSQVPPPGQPTPNQQAPQPPQQQQAPNQQPPPSSQPGPGQMLMAGGPRGSVAQNPGMPQVSSVMEDEILMDLI |
| Length | 227 |
| Position | Unknown |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.241 |
| Instability index | 58.41 |
| Isoelectric point | 4.37 |
| Molecular weight | 24136.99 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22222
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.38| 21| 24| 148| 168| 1
---------------------------------------------------------------------------
148- 168 (46.06/16.18) PPYLLPAPSQVPPP.GQPTPNQ
173- 194 (42.32/14.37) PPQQQQAPNQQPPPsSQPGPGQ
---------------------------------------------------------------------------
|