Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAAGERSTKEKLLSALSDMEVLSRELIEMLALSRTQKLPQPGEDTQVLELLVQRDKEFQELMQTAVEQGRIHQEMQQLEKEAEKRDSDIQLLQKQLKEAEHILATAVYQAKEKLKSIEKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMSNLPTNGVNGHLPGDALAAGRLPDVLTPQYPWQSDVSMGMLPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
Length | 251 |
Position | Middle |
Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes> Characoidei> Characidae> Astyanax. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.691 |
Instability index | 50.71 |
Isoelectric point | 5.04 |
Molecular weight | 27846.99 |
Publications | PubMed=25329095 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22215 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.43| 14| 32| 140| 153| 1 --------------------------------------------------------------------------- 140- 153 (28.63/19.55) SNAVCAPLN.WVPGD 173- 187 (22.80/14.28) SNLPTNGVNgHLPGD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 90.84| 35| 38| 43| 80| 2 --------------------------------------------------------------------------- 36- 75 (44.36/35.50) QKLPQpgE..DTQVlELLVQRDKEFQELMQTAVEQGRihQEM 76- 114 (46.48/26.61) QQLEKeaEkrDSDI.QLLQKQLKEAEHILATAVYQAK..EKL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.46| 16| 43| 154| 171| 3 --------------------------------------------------------------------------- 154- 171 (29.28/23.84) PRRPYPTDLEMrsGML.GH 200- 216 (31.19/18.70) PQYPWQSDVSM..GMLpPH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDVEAMST 2) IIKYAHRI | 234 130 | 241 137 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab