<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22215
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAAGERSTKEKLLSALSDMEVLSRELIEMLALSRTQKLPQPGEDTQVLELLVQRDKEFQELMQTAVEQGRIHQEMQQLEKEAEKRDSDIQLLQKQLKEAEHILATAVYQAKEKLKSIEKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMSNLPTNGVNGHLPGDALAAGRLPDVLTPQYPWQSDVSMGMLPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
| Length | 251 |
| Position | Middle |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.691 |
| Instability index | 50.71 |
| Isoelectric point | 5.04 |
| Molecular weight | 27846.99 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22215
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.43| 14| 32| 140| 153| 1
---------------------------------------------------------------------------
140- 153 (28.63/19.55) SNAVCAPLN.WVPGD
173- 187 (22.80/14.28) SNLPTNGVNgHLPGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.84| 35| 38| 43| 80| 2
---------------------------------------------------------------------------
36- 75 (44.36/35.50) QKLPQpgE..DTQVlELLVQRDKEFQELMQTAVEQGRihQEM
76- 114 (46.48/26.61) QQLEKeaEkrDSDI.QLLQKQLKEAEHILATAVYQAK..EKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.46| 16| 43| 154| 171| 3
---------------------------------------------------------------------------
154- 171 (29.28/23.84) PRRPYPTDLEMrsGML.GH
200- 216 (31.19/18.70) PQYPWQSDVSM..GMLpPH
---------------------------------------------------------------------------
|