<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22207
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | PSPGGFQPSPSPQPSHSPATARTPQSYPLQVPSPGPLNTPGNPNSVMSPAASQSEDQLYMDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLNILTDPNTRCPLKTLQKCEIALEKLKNDMAVPTPPPPTVPSTKKQYLCQPLVDAVLANIRSPVFNHSLYRTFAPAMTAIHGPPITGPVIPTRKRKFEDDDRQTIPNILQGEVARLNSKFLVNLDPTFCSNNGTVHLICKLDDKNLPSVPPLQLSIPADYPDQSPQWDNESHEYEANPFLQNVHKNMTSKLLQLPDKHSVTALLNTWALSVRQACLSAA |
| Length | 315 |
| Position | Tail |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.567 |
| Instability index | 70.09 |
| Isoelectric point | 9.05 |
| Molecular weight | 34926.66 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22207
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.17| 22| 28| 1| 25| 1
---------------------------------------------------------------------------
1- 22 (44.36/20.97) PSPGGFQPSPSPQPSHSPATAR
32- 53 (42.81/13.89) PSPGPLNTPGNPNSVMSPAASQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.45| 19| 28| 90| 108| 2
---------------------------------------------------------------------------
90- 108 (33.93/15.67) LSKMKSLLNILTDPNTRCP
119- 137 (35.52/16.72) LEKLKNDMAVPTPPPPTVP
---------------------------------------------------------------------------
|