<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22201
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MDLAPDNDWRSPGFRQKVVAQIEEAMRKAGTAHAKTSNEMENHVFIKAKSREEYLSLVARLIIHFRDIHKKDQGGPGPMNALQTLNGVGGGGPNTIGMGPRPGAPMGGMAPMGQMPMGQHPLQGVGGIQQDNDWRFPGFRQKVVAQIEEAMRKAGTAHAKTSNEMENHVFIKAKSREEYLSLVARLIIHFRDIHKKAQGGPDPMNALQTLTGVGGGGPNTIGMGPRPGAPMGGMAPMGQMPMGQHPLQGVGGIQQAGTAGQMPMQMGSQQQPLQFQPFQAQQQAAMQPQQQTSMQSNSLQQQQFQQLQKLQMHQQQQQQQHQQQQQQHPNQPLQHQNQQQQAQAQAQAQAQQQQQQQQNQVSVNVSTNVIIMFSRTVRRT |
Length | 380 |
Position | Tail |
Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.819 |
Instability index | 56.83 |
Isoelectric point | 10.13 |
Molecular weight | 41838.95 |
Publications | PubMed=25329095
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22201
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 136.94| 16| 16| 87| 102| 1
---------------------------------------------------------------------------
87- 102 (36.55/11.34) GVGGGGPNTIG...MGPRP
103- 121 (31.92/ 9.12) GAPMGGMAPMGqmpMGQHP
212- 227 (36.55/11.34) GVGGGGPNTIG...MGPRP
228- 246 (31.92/ 9.12) GAPMGGMAPMGqmpMGQHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 368.16| 85| 123| 6| 128| 2
---------------------------------------------------------------------------
6- 85 (161.95/90.42) ......................DNDWRSPGFRQKVVAQIEEAMRKAGTAHAKTSNEMENHVFIKAKSREEYLSLVARLIIHFRDIHKKDQGGPGPMNALQTL
114- 210 (168.32/99.65) QM.....PmgqhpLQgvggiqqDNDWRFPGFRQKVVAQIEEAMRKAGTAHAKTSNEMENHVFIKAKSREEYLSLVARLIIHFRDIHKKAQGGPDPMNALQTL
265- 304 (37.90/15.08) QMgsqqqP.....LQ............FQPFQ....AQQQAAMQPQQQTSMQ.SNSLQQQQF........................................
---------------------------------------------------------------------------
|