<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22199
| Description |
Mediator complex subunit 30 |
| Sequence | MTTPPLAQFPGQQAQAVRDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPNTHQDRLGKLQEHLRMLSVLFRKLRLVYDKCNENCAGLDPIPPEQLIPYVEDDSSKLDDRGASQIRSSSEERREVLEVNKKLKQKNQQLKQIMDQLRNLIWEINSMLAQKDRGDGGRVLR |
| Length | 180 |
| Position | Head |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.667 |
| Instability index | 43.91 |
| Isoelectric point | 8.82 |
| Molecular weight | 20760.59 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22199
No repeats found
|