<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22198
Description |
Mediator complex subunit 30 |
Sequence | MTTPPLAQFPGQQAQAVRDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPNTHQDRLGKLQEHLRMLSVLFRKLRLVYDKCNENCAGLDPIPPEQLIPYVEDDSSKLDDRGASQIRSSSEERREVLEVNKKLKQKNQQLKQIMDQLRNLIWEINSMLAVRS |
Length | 171 |
Position | Head |
Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.585 |
Instability index | 47.36 |
Isoelectric point | 8.48 |
Molecular weight | 19764.51 |
Publications | PubMed=25329095
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22198
No repeats found
|