<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22190
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEIFSTLFGQSEAQGPQGPGTLGFAPGKPPPLPQTQAPAPPQIPAQPGDEGPAARKPGVMNEPFYLLRELPAGNDLTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPIPPAETPSDTDPKKKKKKRDDDPERKKKKKDKKKKKVGKVTKQKL |
| Length | 232 |
| Position | Head |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.994 |
| Instability index | 52.82 |
| Isoelectric point | 9.82 |
| Molecular weight | 25628.32 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.47| 16| 26| 15| 30| 1
---------------------------------------------------------------------------
15- 30 (33.47/17.23) QGPQGPGTLGFAPGKP
43- 58 (32.00/16.15) QIPAQPGDEGPAARKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.06| 14| 19| 190| 203| 2
---------------------------------------------------------------------------
190- 203 (25.72/11.79) PAETPSDTDPKKKK
210- 223 (23.33/10.01) PERKKKKKDKKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.13| 12| 19| 66| 79| 3
---------------------------------------------------------------------------
66- 79 (16.54/13.32) YLLRElpAGNDLTG
87- 98 (24.59/12.66) YNLEH..AYNKFCG
---------------------------------------------------------------------------
|