<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22183
| Description |
Uncharacterized protein |
| Sequence | MDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPLQLPRGMVKSLLYQILDGIHYLHANWVLHRDLVRLCVCACFCRFSGTVVFTFPGKPEDKQSCCIRQLSYKNNDMFHEILYIYIYIYIYIYILFLLQVLVRI |
| Length | 221 |
| Position | Kinase |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.152 |
| Instability index | 37.53 |
| Isoelectric point | 9.07 |
| Molecular weight | 26136.34 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22183
No repeats found
No repeats found
|