<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22176
Description |
Blast:Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MNPNMNMMPMSGPQMMQVMQSSPQPMMPAVPPGPVPQQPLQQQQQAEKLDNISRAKSLLAPLRESMFLTIRSSAFTLQQNNLADNLKRDTGVHGHHVPRFDKHLEDFYAFCDQIELHLKTAMQCLQQQNSSNHYLPGMVTPMRMENFMPENAGPIPYPTYLNTVRVHVQSAKDIHDTLISAAQNISQAD |
Length | 189 |
Position | Tail |
Organism | Drosophila guanche (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.531 |
Instability index | 70.06 |
Isoelectric point | 6.43 |
Molecular weight | 21350.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22176
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.95| 26| 83| 38| 68| 1
---------------------------------------------------------------------------
38- 68 (37.80/25.59) QPLQQQQQAEKldnisRAKSLLAPLRESMFL
123- 148 (50.15/24.19) QCLQQQNSSNH.....YLPGMVTPMRMENFM
---------------------------------------------------------------------------
|