<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22173

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSDRASSTPFQVGPPSPSSPAAGFQKETHSPFVPSDQIPQTPTSPLMSVSTQNYASNFTSSQPSPHQAPSQSANFSSPPSSAPMSTQVSQQPTVSTANSFPTPASSVSGHFVASTSAEDSENMDKSTGNMNQEREATSAQIVEAPSTQPVEHEHRWTDHDRHLGDSGTESKDTSQPVDIDMSTSAPPMKEPAEDFQGKDFTSAFHLCKRPHNATGPDLRLDLISLYGLGPVAKSVARMDPTTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPNTPGGLRHLTMWPEEEWQNQKVFGKEIKVADIDSGLHKLQMNAMKMEPGPIPDNEYWEDVLGHEKPSKSAGAPDAAKKTATPNAVRSTSQSNGTPVPAEPERTRPSRGRKRHYDDSSFVGYGEGYADDDDDVAFYSNTEGIGKKKRKKV
Length422
PositionHead
OrganismAspergillus sclerotialis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Polypaecilum.
Aromaticity0.06
Grand average of hydropathy-0.936
Instability index56.50
Isoelectric point6.07
Molecular weight45708.73
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22173
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     103.51|      22|      24|      60|      81|       1
---------------------------------------------------------------------------
    3-   25 (25.88/ 7.99)	DRA.SStpfqVGPP.SP...S.SPAAGFQ
   26-   50 (22.52/ 6.05)	KET.HS.pfvPSDQ.IP.QTPtSPLMSVS
   51-   76 (31.01/10.95)	TQNyAS.nftSSQP.SPHQAP.SQSANFS
  102-  120 (24.09/ 6.96)	TPA.SS........vSGHFVA.STSAEDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.48|      21|      29|     209|     229|       2
---------------------------------------------------------------------------
  209-  229 (38.78/27.45)	RPHNATGPDL.RLDLI...SLYGLG
  237-  261 (27.70/17.52)	RMDPTTGEKInRLRKSyegKLKGLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.31|      12|      37|     286|     299|       3
---------------------------------------------------------------------------
  286-  299 (19.76/16.72)	PEEE.WQNqkVFGKE
  325-  337 (20.55/10.71)	PDNEyWED..VLGHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     127.05|      40|     221|     125|     166|       4
---------------------------------------------------------------------------
  125-  166 (60.98/32.72)	KSTGNMNQEREATSAQIVEAPStQPvEHEHRWTDHDRHLGDS
  350-  389 (66.07/28.90)	KKTATPNAVRSTSQSNGTPVPA.EP.ERTRPSRGRKRHYDDS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22173 with Med19 domain of Kingdom Fungi
Unable to open file!