Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASSTPFQVGPPSPSSPAAGFQKETHSPFVPSDQIPQTPTSPLMSVSTQNYASNFTSSQPSPHQAPSQSANFSSPPSSAPMSTQVSQQPTVSTANSFPTPASSVSGHFVASTSAEDSENMDKSTGNMNQEREATSAQIVEAPSTQPVEHEHRWTDHDRHLGDSGTESKDTSQPVDIDMSTSAPPMKEPAEDFQGKDFTSAFHLCKRPHNATGPDLRLDLISLYGLGPVAKSVARMDPTTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPNTPGGLRHLTMWPEEEWQNQKVFGKEIKVADIDSGLHKLQMNAMKMEPGPIPDNEYWEDVLGHEKPSKSAGAPDAAKKTATPNAVRSTSQSNGTPVPAEPERTRPSRGRKRHYDDSSFVGYGEGYADDDDDVAFYSNTEGIGKKKRKKV |
Length | 422 |
Position | Head |
Organism | Aspergillus sclerotialis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Polypaecilum. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.936 |
Instability index | 56.50 |
Isoelectric point | 6.07 |
Molecular weight | 45708.73 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22173 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 103.51| 22| 24| 60| 81| 1 --------------------------------------------------------------------------- 3- 25 (25.88/ 7.99) DRA.SStpfqVGPP.SP...S.SPAAGFQ 26- 50 (22.52/ 6.05) KET.HS.pfvPSDQ.IP.QTPtSPLMSVS 51- 76 (31.01/10.95) TQNyAS.nftSSQP.SPHQAP.SQSANFS 102- 120 (24.09/ 6.96) TPA.SS........vSGHFVA.STSAEDS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 66.48| 21| 29| 209| 229| 2 --------------------------------------------------------------------------- 209- 229 (38.78/27.45) RPHNATGPDL.RLDLI...SLYGLG 237- 261 (27.70/17.52) RMDPTTGEKInRLRKSyegKLKGLG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.31| 12| 37| 286| 299| 3 --------------------------------------------------------------------------- 286- 299 (19.76/16.72) PEEE.WQNqkVFGKE 325- 337 (20.55/10.71) PDNEyWED..VLGHE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 127.05| 40| 221| 125| 166| 4 --------------------------------------------------------------------------- 125- 166 (60.98/32.72) KSTGNMNQEREATSAQIVEAPStQPvEHEHRWTDHDRHLGDS 350- 389 (66.07/28.90) KKTATPNAVRSTSQSNGTPVPA.EP.ERTRPSRGRKRHYDDS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KRHYDDSSFVGYGEGYADDDDDVAFYSNTEGIGKKKRKKV 2) YWEDVL | 383 329 | 422 334 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab