<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22170
| Description |
Cyclin-like protein |
| Sequence | MAANFWASSHGKQWLLSRQQLQESRKEDLKYINTLEMMKVNIWFAKLMTDLGNNIGVRQVIIATALTNSYRGTDPYLVAATCMYLACKIEESPHHIKSVIAEMKTVTQDKGGFQYENHKVAEMEFYLLEELNFNMIVFHPYRALTTLAQDLGTKNEDVQRAWFIVNDTYKTDMCLLYPPYVIAAAALYLPIALKGGGQYGDNSTSNDNSAQGVVTRGAKKGATNDANNNGETTKVKDIRQWFALLNVDLDQIIDIVQEIISLYEVWDEYNKNNKKHQEIHGILQRLLKK |
| Length | 289 |
| Position | Kinase |
| Organism | Gigaspora rosea |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Diversisporales> Gigasporaceae> Gigaspora.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.347 |
| Instability index | 30.81 |
| Isoelectric point | 6.39 |
| Molecular weight | 32965.27 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22170
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.69| 20| 196| 43| 62| 1
---------------------------------------------------------------------------
43- 62 (37.52/27.06) WFAKLMTDLGNNIGVRQVII
241- 260 (36.16/25.85) WFALLNVDLDQIIDIVQEII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.22| 17| 102| 68| 85| 2
---------------------------------------------------------------------------
68- 85 (28.71/22.92) NSYRgTD......PYLVAATCMYL
167- 189 (24.51/13.89) DTYK.TDmcllypPYVIAAAALYL
---------------------------------------------------------------------------
|