Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNPINTSNSASKSMIAQNVTLLNEYQALIDRIFASIAANAEGKPTDRPPVEIMKDIVELDKKMQQGLDQIEEHQRVHKKILQIIKEIEAENNAFMEFVNELKNGKEQLEICLDEANETIQAINFSSESSVTADEILKYANRISSYTSAPPNYISGTFAEPPYPDESRMRRSFLFRQDVDIMFDEGDKNDDEDEEEDDGDDMHYIKPNPYSSLEAMQQTEPFNLDLNPDLE |
Length | 230 |
Position | Middle |
Organism | Gigaspora rosea |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina> Glomeromycetes> Diversisporales> Gigasporaceae> Gigaspora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.743 |
Instability index | 48.61 |
Isoelectric point | 4.30 |
Molecular weight | 26275.78 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22166 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.95| 11| 15| 61| 71| 2 --------------------------------------------------------------------------- 61- 71 (19.46/15.10) KKMQQGLDQIE 78- 88 (17.50/12.90) KKILQIIKEIE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.84| 15| 15| 115| 129| 3 --------------------------------------------------------------------------- 115- 129 (24.91/17.83) ANETIQAIN.FSSESS 132- 147 (20.93/13.93) ADEILKYANrISSYTS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDGDDMHYIKPNPYSSLEAMQQTEPFNLDLNP 2) YPDESRMRRSFLFRQDVDIMFDEG | 196 162 | 227 185 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab