<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22165
Description |
Uncharacterized protein |
Sequence | MTQKPRTTPLYDQLEHVEFVRSRMCSVNEAQQEFITYMNEIKEVNWVDYLNRFNIFLSKHVGFSNTFIESNLRKIVVHPKEIPPPEQDEKISFLLRTKRIPEIEEEEERIKHNISIEEDLYQDEKDAIVDMNDETKWDKLLNEWIMRYSEHAKVASTASEFAEGVIGDINTKFRVEDDSNLTSEETGSQGDLTLEKVLSFMSSGTQ |
Length | 206 |
Position | Head |
Organism | Gigaspora rosea |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Diversisporales> Gigasporaceae> Gigaspora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.686 |
Instability index | 50.47 |
Isoelectric point | 4.71 |
Molecular weight | 24141.73 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22165
No repeats found
No repeats found
|