<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22164
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSSFLQSEEFPNEITTPVKGCLIEYEGLIDHFFTAIAGYSEGKKQINQTPIEIMKEIIALDKKLQKGLDLIEEHQKVHRKLLQMENEIDAENQALMDFALALKTGKEQLDVCLDEALIIKRAIRMTEESQVSAKDILEYANKLSQYTSAPPHFNPAIPSSMIAYPPYPDESHMRMGLLFRQYADESFEDEEHSRGEEDEEEDDDEELDHVVNLDETHARSNSFGSVEIVQQTNQTEAFNLDLNPELE |
Length | 247 |
Position | Middle |
Organism | Glomus cerebriforme |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Glomus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.608 |
Instability index | 55.90 |
Isoelectric point | 4.42 |
Molecular weight | 28252.14 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22164
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.97| 12| 17| 163| 174| 1
---------------------------------------------------------------------------
163- 174 (25.38/18.64) AYPPYPDESHMR
183- 194 (21.59/14.71) ADESFEDEEHSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 142.28| 45| 52| 58| 102| 2
---------------------------------------------------------------------------
58- 102 (71.94/52.42) IALDKKL..QKGLDLIEEHQKVHRKLLQMENEIDAENQALMDFALAL
111- 157 (70.34/51.09) VCLDEALiiKRAIRMTEESQVSAKDILEYANKLSQYTSAPPHFNPAI
---------------------------------------------------------------------------
|