<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22162
| Description |
Cyclin-like protein |
| Sequence | MFMLIFMPLFRTNWLLSRQALAECRKIDRQYVTEEELMRVNIWFAQIITDLGRSLQVRQVIVATAITYFKRFYTKNSFRNTEPNLVAATCMYLACKIEESPQHIKAVITDMKTIMQEKGEPFSYDNPKVAEMEFYLLEELNFNMIVYHPYRSLMTLAQDLGTKNEDVHWAWYVINDSYRTDMCLLYPPHVIAAAALYLQIALKGGAQYGDYSLTSMNTANNSSVAGVTTRGAKRGAAAAASNNNNNNNNINTSVNETPKVKDIRLWFAQLNVDLEQIIDIVQEIISLYKLWSEEDKQNEKIRDILNKLLK |
| Length | 310 |
| Position | Kinase |
| Organism | Glomus cerebriforme |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Glomus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.219 |
| Instability index | 43.80 |
| Isoelectric point | 6.46 |
| Molecular weight | 35769.74 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22162
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.55| 20| 24| 205| 224| 1
---------------------------------------------------------------------------
205- 224 (35.42/21.57) GAQYGDYSLTSMNTANNSSV
231- 250 (34.13/20.57) GAKRGAAAAASNNNNNNNNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.86| 21| 22| 264| 285| 3
---------------------------------------------------------------------------
264- 285 (30.16/26.74) RLWfAQLNVDLEQIIDIVQEII
289- 309 (34.70/24.72) KLW.SEEDKQNEKIRDILNKLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.20| 12| 25| 145| 156| 4
---------------------------------------------------------------------------
145- 156 (22.60/16.16) IVYHPYRSLMTL
173- 184 (22.60/16.15) VINDSYRTDMCL
---------------------------------------------------------------------------
|