<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22160
| Description |
Uncharacterized protein |
| Sequence | MTQQQRMNYTGGITQNVTNIDHIEVVRSRMIQVNDAQSEFLANLSVSEDPSWINFLNKFNTFLSKHTGLSNTFIDSTLRKIMLYPKEAPPVELEQIFNTLLRTKQIPEIEILEQEIKQEISLQENLLNLELEIKKNLNDIDDDSKWDKLFDEWEKRYKEHDFIALSSSQICENIFGDINLKNRLSDSIDFDKDLHDDVENIEDLTMEKVLAFMSSGIQEGKGPSK |
| Length | 225 |
| Position | Head |
| Organism | Glomus cerebriforme |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Glomus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.561 |
| Instability index | 55.74 |
| Isoelectric point | 4.61 |
| Molecular weight | 26158.15 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22160
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.31| 15| 37| 48| 63| 1
---------------------------------------------------------------------------
48- 63 (23.05/19.33) EDPSwINFLNKFNTFL
87- 101 (26.25/15.33) EAPP.VELEQIFNTLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.15| 19| 42| 136| 154| 2
---------------------------------------------------------------------------
136- 154 (37.72/22.30) NL.NDIDDDSKWDK.LFDEWE
179- 199 (25.43/12.99) NLkNRLSDSIDFDKdLHDDVE
---------------------------------------------------------------------------
|