<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22158
Description |
Uncharacterized protein |
Sequence | MAANFWASTHGTHWLLNRQQLINSRKDDLKHINEQELTKVNIWFAKIITDLGKNLQVRQIIIATAITYFKRFYTKNSYRGTEPYLVAATCMYLACKIEESPHHIKTVISEMKKLTEGKGGFPYENQKVAEMEFYLMEELDFKMIVFHPYRALATLAQDLGTKNEDVQNAWWVLNDTYRTDMCLLYPPHVIAAAALYLPIALKGENNRYGDNNNNNNDNDNNNNNNNSSSLSGGSNNNLKGGGVVGGGVGGEVGGGAGGVVTRGAKKGQVAAAAAAAAANNGSNIVNSNNNNETSKIEDIREWFALLNVDLEQITDIVQEIISLYELWTEYNEEKPQEILQRLLKK |
Length | 345 |
Position | Kinase |
Organism | Diversispora epigaea |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Diversisporales> Diversisporaceae> Diversispora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.444 |
Instability index | 34.85 |
Isoelectric point | 5.87 |
Molecular weight | 38507.89 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22158
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.80| 16| 65| 214| 229| 1
---------------------------------------------------------------------------
214- 229 (30.99/13.42) NNNDNDNNNNNNNSSS
279- 294 (29.80/12.68) NNGSNIVNSNNNNETS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.95| 20| 256| 43| 62| 2
---------------------------------------------------------------------------
43- 62 (35.23/22.07) WFAKIITDLGKNLQVRQIII
302- 321 (34.72/21.67) WFALLNVDLEQITDIVQEII
---------------------------------------------------------------------------
|