<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22154
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTSLDQDQIKVLEQSRHRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQASIISNNLLSVSDHLSDNRDLLSALVAYPGPSYPGRTQAPTLEQLLRTKLDPRVEDWVSRGRRAGASALEDRDALSEGALAELWDWAPVEANQEARRRNWGGNFTLEETEMGVQNVVTGLRRQLEDEDESESEEEGEGEEEEMEVVGVRRKSGGAAGLEFDIAAPTPGLRQQQQQPQQKAAGPVVPLEDILRYMTTGTLPTQR |
| Length | 251 |
| Position | Head |
| Organism | Aspergillus thermomutatus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.665 |
| Instability index | 67.18 |
| Isoelectric point | 4.60 |
| Molecular weight | 27739.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22154
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.73| 14| 47| 158| 171| 1
---------------------------------------------------------------------------
158- 171 (25.06/13.90) EMGVQNVVTGLRRQ
190- 199 (17.28/ 7.92) EME....VVGVRRK
207- 220 (24.39/13.39) EFDIAAPTPGLRQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.15| 15| 26| 33| 47| 2
---------------------------------------------------------------------------
33- 47 (28.02/17.22) LNQSDPLPSWSSLQS
57- 71 (25.13/14.77) LSVSDHLSDNRDLLS
---------------------------------------------------------------------------
|