Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MTSLDQDQIKVLEQSRHRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQASIISNNLLSVSDHLSDNRDLLSALVAYPGPSYPGRTQAPTLEQLLRTKLDPRVEDWVSRGRRAGASALEDRDALSEGALAELWDWAPVEANQEARRRNWGGNFTLEETEMGVQNVVTGLRRQLEDEDESESEEEGEGEEEEMEVVGVRRKSGGAAGLEFDIAAPTPGLRQQQQQPQQKAAGPVVPLEDILRYMTTGTLPTQR |
Length | 251 |
Position | Head |
Organism | Aspergillus thermomutatus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.665 |
Instability index | 67.18 |
Isoelectric point | 4.60 |
Molecular weight | 27739.33 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22154 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 66.73| 14| 47| 158| 171| 1 --------------------------------------------------------------------------- 158- 171 (25.06/13.90) EMGVQNVVTGLRRQ 190- 199 (17.28/ 7.92) EME....VVGVRRK 207- 220 (24.39/13.39) EFDIAAPTPGLRQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.15| 15| 26| 33| 47| 2 --------------------------------------------------------------------------- 33- 47 (28.02/17.22) LNQSDPLPSWSSLQS 57- 71 (25.13/14.77) LSVSDHLSDNRDLLS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAGLEFDIAAPTPGLRQQQQQ 2) AAGPVVPLEDILRYMTTGTLPTQ | 203 228 | 223 250 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab