| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MATLNLEDDELKALEQTLSKVAQLSSSVQSFRQDLLKSNPLPPPKSIQASAKILQKNLRSLLESTNENADLFNRMAIHPSTNYPGRVHENVLLQLLRKKLEPDVEELVSQGLETSRLATPAGLESLENIWKELRAWLSDRVGYFAANENNDPYTAEERANGTENVRTGLRKGIEDDEDDEDEDEEETEQAAAPVQVRGPEPETLLWFAARGDFEVPRNVEYERKEDAFRGIYVYKGLQGVGIPFTAQSSPQLQQDSTPL |
| Length | 259 |
| Position | Head |
| Organism | Fusarium longipes |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.720 |
| Instability index | 53.66 |
| Isoelectric point | 4.57 |
| Molecular weight | 29107.89 |
| Publications | PubMed=29649280 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP22135
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 246.96| 60| 72| 89| 149| 1
---------------------------------------------------------------------------
14- 68 (62.40/29.61) ...LEQTLSKvaQLSSSVQSFRQDLLKSNPLPPPKSIQASAKILqKNLRSLLE......STNEN
89- 149 (94.88/51.49) ENVLLQLLRK..KLEPDVEELVSQGLETSRLATPAGLESLENIW.KELRAWLSDRvGYFAANEN
163- 218 (89.68/45.15) ENVRTG.LRK..GIEDDEDDEDEDEEETEQAAAPVQVRGPE....PETLLWFAAR.GDFEVPRN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FRGIYVYKGL 2) FRQDLLKS 3) KSIQASAKILQK 4) TLLWFAAR | 228 31 45 203 | 237 38 56 210 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab