<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22123
Description |
Rna polymerase ii holoenzyme cyclin-like subunit |
Sequence | MSANYWQSTQCRFWNFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLNIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVYQPYRTITALRSELGLQEDEVQLARSVINDHFMTDLPLLYPPHIIAMVAMLLALVLRPNNSGPGQNASGAAAAAGLAAAQQALMRAQGQQMSGGTADAATAEPKERQQQARVSRVQKFAKWLVDSNVDIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
Length | 319 |
Position | Kinase |
Organism | Fusarium sp. FIESC_12 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium incarnatum-equiseti species complex.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.289 |
Instability index | 55.57 |
Isoelectric point | 8.96 |
Molecular weight | 36547.68 |
Publications | PubMed=29649280
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22123
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.59| 14| 22| 214| 227| 1
---------------------------------------------------------------------------
214- 227 (23.89/14.95) GQNASGAAAAAGLA
238- 251 (25.69/16.55) GQQMSGGTADAATA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.72| 12| 22| 64| 84| 2
---------------------------------------------------------------------------
69- 84 (11.06/29.74) MATAqVYMKrfySKVE
94- 105 (20.66/ 7.17) IATA.IYLA...CKIE
---------------------------------------------------------------------------
|