Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MATLNLEDDELKALEQTLSKVAQLSSSIQSLRQDLLKSNLLPPPYVVPHRICAIKLRSLLESTTENADLFNRMAIHPSTNYPGRVQENVLLQLLRKKLEPDVEELVSQGLETARLATPAGLESLENIWKELRSWLTDRVGHFAANENNDPYTAEERANGTENVRTGLRKGIEDGDDDDEEDEEEDDEDEEEQEPTTAPVQVRGPEPETLLWFAARGDFEVPRNVEYERKEEPYKGIYVYKGLQGVGVPPTAQVAPPQAQQDFAPS |
Length | 265 |
Position | Head |
Organism | Fusarium sp. FIESC_12 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium incarnatum-equiseti species complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.746 |
Instability index | 57.98 |
Isoelectric point | 4.44 |
Molecular weight | 29804.61 |
Publications | PubMed=29649280 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22122 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 148.62| 35| 35| 122| 156| 1 --------------------------------------------------------------------------- 87- 119 (35.91/19.30) ...ENVlLQLLRKKLEPDVEELVSQGLETARLATPA 122- 156 (57.77/35.51) ESLENI.WKELRSWLTDRVGHFAANENNDPYTAEER 158- 192 (54.93/33.41) NGTENV.RTGLRKGIEDGDDDDEEDEEEDDEDEEEQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 94.73| 29| 31| 23| 51| 2 --------------------------------------------------------------------------- 23- 51 (49.67/35.44) QLSSSIQSLRQ..DLLKSNLLPPPYVVPHRI 55- 85 (45.06/31.52) KLRSLLESTTEnaDLFNRMAIHPSTNYPGRV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PRNVEYERKEEPYKGIYVYKGLQGVGVPPTAQV 2) TLLWFAAR | 221 208 | 253 215 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab